Import Old Data To New Mysql Database
My machine was down before, fortunately I have back up the whole
/usr/local/mysql directory. Now I have setup a new mysql on a new
machine, how can I import the old data back to the new database??
My old mysql version: mysql-3.22.32
new mysql version: mysql-max-4.0.3-beta-sun-solaris2.7.sparc
I used to run the mysql like this:
/usr/local/mysql/bin/mysql abc
should I add the user abc to my new database first? and how?
View Complete Forum Thread with Replies
Related Forum Messages:
Import Excel Data Into Mysql Database
I am new to MYSQL..I have a excel sheet with 4 colums and several rows of data.. I need to import all these into a database which i have created in mysql..I tried using LOAD DATA LOCAL INFILE 'D:student.xls' INTO TABLE test.student FIELDS TERMINATED BY ' ' ENCLOSED BY '' ESCAPED BY '' LINES TERMINATED BY ' '; But i get error saying Data truncated at column'x'..
View Replies !
Import Data From Database
I need to convert data in a MYSQL database into a format that Microsoft Access can accept. I need a SQL statement to import the data from the existing mySQL database to Microsoft Access
View Replies !
Import Database Overwrite And Data Elimination
When I imported files from one mysql database to another,I got no error messages, so the import was successful, but it also eliminated the information I had in the database into which I was importing. I thought the information would just be added to the information that was already existing. Any ideas of what could have happened?
View Replies !
Import Data Into Mysql
is there a way around it, other than scrubbing the data ? currently, the dates are in mm/dd/yyyy format if i want to use in import file with fields that have this format, is there any way of applying a conversion to that field on the fly ?
View Replies !
Access To Mysql (import Data)
I have been using MS Access for some time and want to convert/move to mysql I should like to import the tables rather than re entering all the data can anyone point me in the right direction or where I can find a good intro to MYSQL?
View Replies !
Import Data From Text File Mysql
Im going to write a script in linux that updates my mysql database. How can i write a sql statemtn that updates my mysql table from a text file located on my machine? lil confused bout the path of the txt file?
View Replies !
Import Data From .txt File Into MySQL Table
i have text files which are generated daily and stored in a folder on the C: drive. I was wondering what would the mySQL command be to import that data into a mySQL table. The text file does not have a header with the field names so would i have to make that table first with the desired columns?? Also, does the file have to be in the databse directory or can it be anywhere on the machine??
View Replies !
#1064 MySQL Error On Data Import
I know this has to be a simple problem, but it is driving me mad. PHPMyAdmin will allow me to import a SQL insert one line at a time no problem, but when I attempt to import more than one at a time it give me an error saying that my syntax is incorrect. I have tried to import the entire database and it just runs until the 300 sec time out. This wouldn't be so much of a problem to do it one line at a time, but my database is almost 4000 lines in length. Here is the error: #1064 - You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'INSERT INTO `contact_images` VALUES (2,1,'alcohol_10.jpg') INSERT INTO `contact' at line 2 PHP CREATE TABLE `contact_images` ( `id` int(11) NOT NULL auto_increment, `cat_id` int(11) NOT NULL default Ɔ', `path` varchar(255) NOT NULL default '', PRIMARY KEY (`id`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ; and here is a small example of what the data is: PHP INSERT INTO `contact_images` VALUES (1,1,'alcohol_1.jpg') INSERT INTO `contact_images` VALUES (2,1,'alcohol_10.jpg') INSERT INTO `contact_images` VALUES (3,1,'alcohol_11.jpg') INSERT INTO `contact_images` VALUES (4,1,'alcohol_12.jpg') INSERT INTO `contact_images` VALUES (5,1,'alcohol_13.gif') Like I said, it will allow me to insert each line one by one.. but when I try to do more than one at a time it gives me the error. I have been searching around about the #1064 error and a lot of what I am reading seems to point at the CHARSET, I have tried multiple types of CHARSETS, but I just cannot figure out what the issue is with this. I was told to try and import the entire database via SSH and that didn't work either. I am running MySQL version 4.1.21 and PHPMyAdmin 2.8.2.4. I must be totally missing the issue on this. Can anyone see a problem with me database structure/data?
View Replies !
Easiest Way To Export And Import Data From MySQL?
I wonder what is the easiest way to export data in some kind of text file, edit it in text editor and then import back to MySQL? Is there such software? I'm asking this because I need to export one table to text file and give it to tranlsator. Then I need to import it back to MySQL.
View Replies !
I Want To Import My Data From Access Into My MySQL DB Online
I have a MySQL database which i access/modify/interact with via PHPMyAdmin. I have a table with about 20 fields and 609 rows which i need to import into my MySQL database. not all of the fields are the same, not all need to be imported, and all of the field names are different in my MySQL db. Is there a software i can get to make this process easier. or can i export the access table to some format and import it by specifying what datafields from the access table map to what datafields in the mySQL table? I've posted a similar request recently, but this one is much simpler. just need to get some data out of access and into mysql. Would great appreciate any help or software referrals etc. Much love and a merry xmas
View Replies !
Import Of Database In Mysql
I get this error when I am importing the database. What am I doing wrong? ERROR 1064 at line 625735: You have an error in your SQL syntax near ' begin_excerpt varchar(250) default NULL, PRIMARY KEY (id) ) TYPE=MyISAM' at line 5
View Replies !
What Database Do You Use To Import Into MySQL
I am setting up a MySQL database and find phpmyadmin very slow to enter data, so I am thinking of importing all the data from Microsoft Access 2003 instead. Or I could create a php page to enter the data. What do you guys use as your main database to import into MySQL?
View Replies !
Import Update Of Csv/excel Data Into MySQL Table
I need to import some data from csv or excel files in my customers table so that for each customer ID it will update an existing field. My tools for accessing the database on the server is phpMyAdmin, but I could of course also copy the database down, manipulate on the PC, and then re-upload the entire manipulated database.
View Replies !
Import Database From MySQL3.x To MySQL 4.x
I want to import a MySQL 3.x Databse to my new shiny MySQL4.x. I did a backup with /usr/local/mysql-standard-4.0.14-pc-linux-i686/bin/mysqldump -u root -p --opt -A > mysql_lamp_backup.`date '+%Y.%m.%d'`.sql And i tried to import it to MySQL4.x with: /usr/local/mysql/bin/mysql -u root -p < mysqlbak The error: ERROR 1064 at line 598: You have an error in your SQL syntax. Check the manual that corresponds to your MySQL server version for the right syntax to use near '-en' at line 1 This is teh line 598: CREATE DATABASE /*!32312 IF NOT EXISTS*/ blabla-en; IF i change the name to blabla_en, it works fine. #### Another issue: ERROR 1064 at line 830: You have an error in your SQL syntax. Check the manual that corresponds to your MySQL server version for the right syntax to use near '! ,'poll','Questions','','',10,'r',11.61,11,10,00100 00000010000,'','A'), ANd this 830 line ist just far to long to post it :) So do i have a general problem or what did i do wrong so far? Cheers, Mario -- COMPUTERBILD 15/03: Premium-e-mail-Dienste im Test -------------------------------------------------- 1. GMX TopMail - Platz 1 und Testsieger! 2. GMX ProMail - Platz 2 und Preis-Qualitätssieger! 3. Arcor - 4. web.de - 5. T-Online - 6. freenet.de - 7. daybyday - 8. e-Post
View Replies !
Export/Import MySQL Database
I am writing an application usig PHP/MySQL on my local development box. Now that the app is complete, I am ready to move it into production and live on the domain. What is the best way to go about moving that database from the local MySQL platform onto my hosting?Should I export it into a SQL file and rebuilt it on the host?
View Replies !
How Do I Import .csv File Into My Mysql Database?
I woould like to know how to import csv files into my mysql databse, I tried the: LOAD DATA LOCAL INFILE '/importfile.csv' INTO TABLE test_table FIELDS TERMINATED BY ',' LINES TERMINATED BY '' Commands but I dont know where would i put these command and wher do put the "importfile.csv", what directory and location?
View Replies !
Import .xls File Into A Mysql Database
I have a .xls file that i would like to import into a mysql database, I am ok creating the mysql table in phpmyadmin on my webspace but i cant work out or find any useful tutorials on how to import the database from the .xls format and get it into the database short of building a form and submitting by hand which would take far to long.
View Replies !
Import Excel File Into Mysql Database
I was looking for information on how to import an excel file or other text file into a MySql database. I have done this with both access and SQL Server and am looking for a way to do this in MySql. I have several hundred items i want to import into a parts database that is currently in an excel file but can be saved as comma separated or other format.
View Replies !
Import A Directory Of Text Files Into A Mysql Database With Php?
I have a directory of text files that i'd like to import into a msql table... I was wondering if there's an easier way to do this with php/mysql, I'd like to avoid copy/pasting the entire directory (thousands of files) into the database if i can. The directory structure of the text files resembles... somepath/A/Aerosmith/Song Name.txt - (extention varies) What i'd like to do is use php to scan the directory and input the file path information and the content from each file into a table like... Dir Artist Song Text Type ------------------------------------------------------------------------ A Aerosmith Song Name Fa La La La La (example text) File Ext B Beatles Song Name Fa La La La La (example text) File Ext
View Replies !
Import Excel Sheet Datas To A Mysql Database
I have a dotnet application in which i have to import data from an excel sheet and store datas in mysql table to display those datas in my dotnet application. Iam using this datas to display datas for generating employee salary slip in my dotnet application. pls do help me with source code in C#.
View Replies !
LOAD DATA INFILE To Import Data Exported From A MS Access Xp
I am trying to use LOAD DATA INFILE to import data exported from a MS Access Xp table. But all i get in the date field is 00:00:00, as Access exports DATE and TIME and MySQL seems to use just the TIME portion of this. Is there any way to ahve MySQL import just the DATE portion or is there any way to have Access export only the DATE portion?
View Replies !
Import Old Data To New
My machine was down before, fortunately I have back up the whole /usr/local/mysql directory. Now I have setup a new mysql on a new machine, how can I import the old data back to the new database?? My old mysql version: mysql-3.22.32 new mysql version: mysql-max-4.0.3-beta-sun-solaris2.7.sparc I used to run the mysql like this: /usr/local/mysql/bin/mysql abc should I add the user abc to my new database first? and how?
View Replies !
Sql Import Data
I have a rather large file that I gzipped and imported into a database (a forum). I configured the forum to access the database and viewed it. It all worked fine except for the fact that it doesn't display umlauts or any other "special" chars, like double-quotes, etc. properly. A ü becomes ü and so on. I un-gzipped the file and checked it with a text-editor and the umlauts and all other chars are fine in the file, displaying correctly. The charset that was used in the sql file was latin1 so I thought I'd switch it to utf8 and re-do the import. Didn't help though.
View Replies !
Data Import Error
I have a table with 82 columns, and l load data into it from a delimitted file that doesn't always have data for all of the columns, 70% of the file will only have data for the first 60. In version MySQL version 4.1.7 this wasn't a problem, but it is in version 5.0.18. I get this error: Row 1 doesn't contain data for all columns, when using table.. - this happens with mysqlimport as well as load data infile. In either scenario I'm using W2K3.
View Replies !
Import Access Data
I have a database that contains information on items for sale, prices, etc. Every few months or so, I need to import data from an access database, to do the following: - insert any new items from the access database into the mysql database - update any of the current items with new information (such as price) I've done a good bit of searching on this, but most of the answers here revolve around a one-time import...this is something that needs to happen regularly.
View Replies !
Import Data From CSV With Sqlyog
I am import data from csv with sqlyog, but always have warnings and I can´t import it. My configuration is: - Terminated By: ; - Enclosed by: ; - Escaped by: ; - Fields terminated by: ; - Fields enclosed by: ;
View Replies !
Import Data From OpenAccess
I have a client using a program written in OpenAccess 4 in 1987 (this is still a DOS based program). We need to convert the data (saved as a df file) to Mysql. Does anyone have a tool that will do that? I can look at the data with notepad, put it has a lot of extra characters in it.
View Replies !
Split/Import Data
I have tables from several different DB's (dbaseIII, Access etc..) that I need to bring into Mysql. I can convert the tables to a Mysql format without any problems but I need to merge and/or split almost all of the tables. Many of them have address information to be consolidated, order information to be separated, duplicates removed etc.. Does anyone know of a gui to help out on this? Something I can visually map old fields to fields in the new tables?
View Replies !
Import Data From MSSQL
I have two systems, one using MSSQL and one using MySQL. On a daily basis, I need to import information from tables on the MSSQL database to a table on the MySQL database. What's the easiest way to do this?
View Replies !
Error Import Data
I exported data with mysqldump, and now i want to import it in another pc, mysql version same. but i got error: ERROR 1064 (42000) at line 57: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near ''ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDV' at line 1 how i could fix it?
View Replies !
Import Differantial Data
Everyday day, i produce a text file (f1) nearly the same i produced the day before (f2) that i'd like to import into a mysql table (t1). I could use LOAD DATA with "replace" option but it doesn't suit me cuz it would run all lines from f1. I would like first to create a differential file from f1 and f2 that would be f3. Then, i only need to import f3 in mysql. I guess i could use the diff and/or the grep commands from linux. Someone can give me some hints or links ?
View Replies !
Import / Export Data
I have some .db files containing a lot of data that I want to 'port' to my newly constructed MySQL database. Please advise some hints or suggestion of how to deal with that. Is it possible to export the tables from .db file to csv and import it to my new database?
View Replies !
Trying To Import Data From Csv Into Table
I am trying to use mysqladmin import tool to import data into a table. I used mysqladmin to export a table in a csv excel format. I then opened that spreadsheet and filled in a bunch of info. Now I am trying to import that spreadsheet back into the table, but everytime I do I get an error: Invalid field count in CSV input on line 1. I am using the import tool using csv as the format, and I am not changing any of the options... MySQL - 4.1.18-standard-log Protocol version: 10 phpMyAdmin - 2.8.0.2
View Replies !
Data Import From Text File
When I try to import a text file with new data for an existing table I get the error "1148 - the used command is not allowed with this MySQL version." I have tried with both PHPMyAdmin2.3 and with MySQLFront 2.5. Both these GUI programmes have an "import from text file" command which I have used successfully several times to add entries to this table before - running just this MySQL version. I have structured the data in the text file in just the same format as previously. Both these programmes are connecting to the database successfully now and will display the contents of the existing table data and strcutre of the database etc (despite an earlier connection problem which seems to have been solved spontaneously). But both now deliver exactly this error message (and therefore I assume it is MySQL and not the interface programmes which is doing it).I cannot see that I am doing anything different. I have MySQL 4.0.12 on Windows ME PC with a local Apache server and PHP.
View Replies !
Quick Way To Export & Import Data
I have zero experience with SQL but administer a server that runs multiple MySQL databases. I am looking for a quick way to export a single table from a database, drop a column (or field, not sure how to refer to them) and then re-import it or it's data (thus overwriting) another table that contains all of the same data except for this one column.
View Replies !
Import Data Via Ssh Into An Existing Table
I want to import data from several .sql files into an existing database, into one table. I tried using the following command: mysql -e [sqlfile] [db_name] But the problem was when I imported the next file, it would overwrite the previous imported data. Could anyone let me know how to do this correctly, please?
View Replies !
Import A Csv To Update Only Certain Rows Of Data?
I have an existing mysql table and a csv. I want to import the csv into the table, but it is at a different sort order. There are too many records to sort my csv by hand to match. There is a common 'cd_code' field that both have. Is it possible to import a csv to the table so that each row of the csv is inserted in the correct row of the table, based on the common 'cd_code' field? For example, if I sorted by cd_code asc, it would match the csv, but how to I import the csv into a particular sort?
View Replies !
Import Non Normalized Excel Data
So I've got all of my data in csv. Should I import into MySQL directly and then attempt to normalize, or should I try to normalize first, creating individual tables and then import my data. One current problem I am having with the latter is I've got one column with 10k rows. Of those 10k there are 3k unique values. Manually completing find and replace is going to be a chore (3k is less, but still a bit more than I care to do). Is there something built into MySQL that'll help speed things up a bit?
View Replies !
Import Data From Shell Script
I've a comma separated file and would like to use "LOAD DATA LOCAL INFILE..." inside a shell script to import data into a table. Basically, I want the script to connect to database, complete import using "LOAD DATA..." and exit. I understand, rows can be inserted one by one using database handles but I'd like this to be done using "LOAD DATA..." functionality.
View Replies !
Import Data And Create New Table?
I have two CSV files that have the same columns but for two different years (2007 and 2008). I then need to import these two CSV files to one table in MySQL. How do I do that in the easiest manner? I have tried to use the following for importing the first CSV file: Load data infile "C:/Desktop/2007total.csv into table Mat fields terminated by ';' optionally enclosed by '"' lines terminated by '
View Replies !
|